<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V F116Y V106M, Y188C, G190GA   E6K, V35T, T39E, S48T, S68SG, T69TN, K102KNRS, K122E, I135IV, T139TA, K173A, Q174K, D177E, T200A, I202V, R211K, F214L, V245Q, A272P, T286A, E291D, V292I, I293V, Q334E  
>707PKE17F| codons 1-335
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKSKKSMTVLDVGDAYYSVPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLCVASDLEIGQHRAKVEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, N37Q, R41K, K45R, L63P, H69K, L89M, I93L  
>707PKE17F| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDIQLPGKWKPRMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011