<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
707PKE13F 707PKE13F South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 44

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DGNS, K70R, M184V T215TI, K219E K103N, Y181C A98AG P4S, V35T, T39N, S48T, V60I, S68SG, T69TN, V90VI, V118VI, S162N, K173T, Q174K, D177E, T200A, I202V, Q207A, R211K, F214L, D218DE, L228LR, V245Q, A272P, V292I, I293V, P294A, I329V, Q334E  
>707PKE13F| codons 1-335
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKITKIGPENPYNTPI
FAIKKKSGNRWRKLVDFRELNKRTQDFWEIQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTKNPEIVI
CQYVDDLYVGSDLEIGQHRAKVEELRAHLLKWGLITPEEKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVALTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36I, R41K, H69K, I72IV, L89M, I93L  
>707PKE13F| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAVGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011