<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69~ K219R K103N, V106M F227L K20R, T27S, V35T, T39E, S48T, V60I, S68N, K122E, D123S, T165I, K173A, Q174K, D177E, I195IL, G196E, T200A, Q207E, R211K, F214L, K223Q, L228R, V245Q, L283LI, E291D, V292I, I293V, S322T  
>707PKE11F| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKRKDN~KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAKNPEIVI
YQYMDDLYVGSDLELEQHRAKIEELREHLLKWGLTTPDRKHQQEPPLRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, E35D, M36I, R41K, D60E, Q61E, H69K, L89M, I93L  
>707PKE11F| codons 1-99
PQITLWQRPLVSIKVGGQTREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011