<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
707PKE04F 707PKE04F South Africa 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 19
2 3TC+AZT+EFV 91

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, M184V, T215Y V75M V106M, G190GA V179VD, F227L I31L, V35T, E36EA, T39E, V60I, A98AS, L109LI, K122E, D123S, S163SC, T165TI, K173T, Q174N, D177E, T200A, Q207A, R211K, V245T, A272P, E291D, V292I, I293V, E298EK, D324E, I326IV  
>707PKE04F| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTAICEELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPSGLKKKKSMTVIDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSCMIKILEPFRTNNPEIDI
YQYVDDLYVASDLEIGQHRAKIEELRAHLLKWGFYTPDKKHQKEPPLLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEKAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19V, M36I, R41K, L63T, H69K, T74S, L89M, I93L  
>707PKE04F| codons 1-99
PQITLWQRPLVTIKVGGQVKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Green, TN Drug resistance and coreceptor usage in HIV type 1 subtype C-infected children initiating or failing highly active antiretroviral therapy in south Africa. ARHR, 2011