<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SK9004-PI SK9004-PI Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, L19T, K20I, M36I, K43R, L63H, I64M, H69K, L89M  
>SK9004-PI| codons 1-99
PQITLWQRPLVTVRIEGQTIEALLDTGADDTVLEEINLPGRWRPKMIGGIGGFIKVRQYD
QIHMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39S, I135V, S162A, K173T, Q174R, D177E, T200A, Q207E, V245Q, A272AP, K281KR, T286A, E291D, V292I, I293V, P294A  
>SK9004-PI| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICSEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDIVALTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Aghokeng, AF Scale-up of antiretroviral treatment in sub-Saharan Africa is accompanied by increasing HIV-1 drug resistance mutations in drug-naive patients. AIDS, 2011
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011