<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-170 CB-170 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S, L90M L33F I13V, D60E, L63E, I64V, I66F, V77I  
>CB-170| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVRQYE
QIEVEFCGHKAIGTVLIGPTPSNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       E28EK, D123E, I135V, S162C, G196E, T200A, Q207H, R211K  
>CB-170| codons 1-248
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIEELRHHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPE

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005