<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SK8013-PI SK8013-PI Cameroon 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, H69K, T74S, L89M  
>SK8013-PI| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, I135IV, I142V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207DN, R211K, V245Q, T286A, I293V, P294A, L295M L80LF
>SK8013-PI| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFREFNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVAMTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Aghokeng, AF Scale-up of antiretroviral treatment in sub-Saharan Africa is accompanied by increasing HIV-1 drug resistance mutations in drug-naive patients. AIDS, 2011
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011