<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-168 CB-168 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| D4T| IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A   L10I, N37D, L63T, C67D, V77I, I93IL  
>CB-168| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFIKVRQYD
QITIEIDGHKAIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K43T, K103KR, Y144YF, K154KE, T165TP, G196GE, R211K P150PS, S191SF
>CB-168| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELETEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRFQYNVLSQGWEGSPAIFQSSMPKILEPFRKQNPDIVI
YQYVDDLYVGFDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWT

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005