<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SK1017-PI SK1017-PI Cameroon 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, K20R, E35D, M36I, R41K, R57K, D60E, I62V, I64IV, H69Q, L89LM  
>SK1017-PI| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLVEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, D123E, I135T, K173A, Q174K, D177E, Q207E, R211RK, P243A, V245Q, E248D, D250S, A272P, Q278HY, K281KR, T286TA, I293V, E297A, L303LM  
>SK1017-PI| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIKVKYLCRLLRGAKALTEVVPLTAEAE
LEMAENREILKEPVHGVYYD

References
Author Title Citation
Aghokeng, AF Scale-up of antiretroviral treatment in sub-Saharan Africa is accompanied by increasing HIV-1 drug resistance mutations in drug-naive patients. AIDS, 2011
Aghokeng, AF High failure rate of the ViroSeq HIV-1 genotyping system for drug resistance testing in Cameroon, a country with broad HIV-1 genetic diversity J Clin Microbiol, 2011