<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-162 CB-162 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| DDI| DDC| D4T| IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A   T12S, L19V, I62V, L63S, A71V, I72M L5P
>CB-162| codons 1-99
PQITPWQRPLVSIKIGGQVKEALLDTGADDTILEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVSIEICGHKVMGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y       V60I, K122E, I135T, T139M, K173E, T200I, Q207E, H208Y  
>CB-162| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELREYLLRWGFYTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005