<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-160 CB-160 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| RTV| SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, F53L L10I, N37ST, R41K, D60E, L63P, H69Y, A71V  
>CB-160| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMSLPGKWKPKLIGGIGGLVKVRQYE
QIPIEICGYKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y V75T, F77FL, K219R     K20R, I31IL, V35I, R83K, V148G, K166R, Q207QE, H208Y, R211K, K223Q Q91QK, A114AE, S117S*PQ
>CB-160| codons 1-233
PISPIETVPVKLKPGMDGPRVKQWPLTEEKLKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLTDLRELNKKTQDFWEVKLGIPHPAGLKKKKSVTVLDVGDEYFQVPL
DKDFRKYTAFTIPSINNETPGIRYQYNGLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDRKHQQEPPFLWMGYE

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005