<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-157 CB-157 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDC| D4T| RTV| SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84IV, L90M F53FL L10LI, I15V, K20R, E35ED, M36I, I62V, L63P, H69K, A71IV  
>CB-157| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGLVKVRQYD
QVPIEICGKKIIGTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184I, L210W, T215Y K219R     K43KQ, E44D, W88WR, V118I, D123E, I135IT, S162C, G196E, E203K, Q207E, R211K, K223Q, L228R N54NK, N57NK, W239W*, V241VE
>CB-157| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPEKPYKTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFREVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDRKHQQEPPFRWMGYELHPDK*T
EQPIVLPEKDS

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005