<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-155 CB-155 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| DDI| DDC| D4T| PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R T215I, K219Q     I50IM, V90I, D123E, I135T, F214L L80LF
>CB-155| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKMGPENPYNTPV
FAIKKKNSDRWRKLVDFREFNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A, L90M   T12N, L19I, E35D, M36I, N37NS, L63P, K70KE, A71AV, V77VI R87RI
>CB-155| codons 1-99
PQITLWQRPLVNIKIGGQIKEALLDTGADDTILEDISLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHEVIGTVLIGPTPANIIGINLMTQIGCTLNF

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005