<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-153 CB-153 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDC| D4T| IDV| SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   E35D, N37E, D60DE, L63P, A71T, V77VI, I93L  
>CB-153| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     E6D, D123E, K166R, E203ED, R211RK, E224ED, D256E  
>CB-153| codons 1-256
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIDELRQHLLKWGFFTPDQKHQKDPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNE

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005