<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-140 CB-140 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| SQV| RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73S L10I, T12P, I15IV, L19I, K20I, M36MI, N37S, I62IV, L63P, A71V, I72L  
>CB-140| codons 1-99
PQITLWQRPIVPIKVGGQIIEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVLSTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74LV, M184V, L210W, T215Y   Y181C, G190A   V35X, T39TA, K102R, K122E, I135T, F171FY, V179I, G196E, R211K, K223Q K13KN
>CB-140| codons 1-236
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALXEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIII
CQYVDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQQEPPFLWMGYELHP

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005