<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-137 CB-137 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDC| D4T| IDV| RTV| SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54IV, V82VA   L10LI, I13IV, N37T, L63Q, I64V, T74S, V77I  
>CB-137| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIVGIGGFVKVRQYD
QIQVEICGHKAIGSVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67NT, T69DN, K70KR, M184V, T215F K219Q     A62AP, T107TP, K122E, D177E, V179VI, Q207E  
>CB-137| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FPIKKKTSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVPVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKD

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005