<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CB-128 CB-128 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| 3TC| DDI| DDC| D4T| IDV| RTV|RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S L33F, T74P I13V, N37D, L63P, C67Y, H69K, A71V, V77I  
>CB-128| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEIYGKKVIGPVLIGPTPSNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML D67DA K103N, G190A   T27TS, T39S, R83K, T107TP, D237E  
>CB-128| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICSELEKEGKISKIGPENPYNTPV
FAIKKKASTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVPVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPEKWT
VQ

References
Author Title Citation
Balotta, C Prevalence of multiple dideoxynucleoside analogue resistance (MddNR) in a multicenter cohort of HIV-1 infected Italian patients with virologic failure. JAIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005