<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     P4S, K20R, V21I, V35I, T39N, T69S, K122E, D123N, I135L, S162C, K173S, Q174K, D177E, V179I, G196E, T200A, I202V, Q207A, R211K, V245Q, E248D, R284K, T286A, E291D, V292I, I293V, P294T, L295M, E297K  
>CP076302062| codons 2-307
ISSIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICNEMEKEGKISKIGPENPYNTPVF
VIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
ENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRSKNPEIIIY
QYMDDLYVGSDLEIEQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTDIVTMTKEAEL
ELAENR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20KI, M36I, N37ND, R41RK, L63P, G68GE, H69KR, L89IM  
>CP076302062| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICERKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hamers, RL HIV-1 drug resistance in antiretroviral-naive individuals in sub-Saharan Africa after rollout of antiretroviral therapy: A multicentre observational study. Lancet, 2011