<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P140 P140-64 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 48
3 3TC+AZT+EFV+IDV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82F   I13V, I15V, R41K, I64V, K70R  
>P140-64| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPFNIIGRNLLTQIGCTLNF
>P140-64| H03 | codons 1-99 | clone H03
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHRAIGTVLVGPTPFNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215F K219Q K103N   V35K, T39A, V60I, K104N, I135T, I142V, G196E, I202V, L228H  
>P140-64| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFHW
>P140-64| H03 | codons 1-229 | clone H03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFHW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005