<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K14NS, I15V, L19T, K20R, M36I, R41K, D60E, L63V, H69K, I72T, L89M, I93L R87RG
>CP076305056| codons 1-99
PQITLWQRPVVTISVGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIVIEICGKKATGTVLVGPTPVNIIGGNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, K173T, Q174K, D177E, I178M, T200E, Q207E, R211RK, V245Q, A272P, K277R, E291ED, I293V, P294PS, L325V, Q330P  
>CP076305056| codons 1-331
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHREKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDVVSLTEEAE
LELAENREILKEPVHGVYYDPSKDVIAEIPK

References
Author Title Citation
Hamers, RL HIV-1 drug resistance in antiretroviral-naive individuals in sub-Saharan Africa after rollout of antiretroviral therapy: A multicentre observational study. Lancet, 2011