<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P133 P133-40 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37S, L63P, H69Y  
>P133-40| H01 | codons 1-99 | clone H01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P133-40| C01 | codons 1-99 | clone C01
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P133-40| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P133-40| H08 | codons 1-99 | clone H08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y V75L K101E, K103N V108I E28K, K122E, T139M, G196E  
>P133-40| H01 | codons 1-229 | clone H01
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFCTPDKKHQKEPPFLW
>P133-40| H08 | codons 1-229 | clone H08
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLW
>P133-40| C01 | codons 1-229 | clone C01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLW
>P133-40| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005