<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P132 P132-71 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 23
3 3TC+AZT+EFV+IDV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A   L10I, T12I, I13V, G16E, K20R, M36I, I62V, L63A, A71V  
>P132-71| B07 | codons 1-99 | clone B07
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVATEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNL
>P132-71| B04 | codons 1-99 | clone B04
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGKNLLTQIGCTLNF
>P132-71| codons 1-99
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-71| B05 | codons 1-99 | clone B05
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-71| B02 | codons 1-99 | clone B02
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-71| B08 | codons 1-99 | clone B08
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-71| B01 | codons 1-99 | clone B01
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P132-71| B06 | codons 1-99 | clone B06
PQITLWQRPIVIVKIEGQLREALLDTGADDTILEEINLPGRWKPKLIGGIGGFIKVRQYD
QIAIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q L100I, K103N   K20R, K102R, K122E, D123E, I135T, V179I, G196E, L228H  
>P132-71| codons 1-229
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B01 | codons 1-229 | clone B01
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B06 | codons 1-229 | clone B06
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B05 | codons 1-229 | clone B05
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGEISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B04 | codons 1-229 | clone B04
PISPIKTVPVKLKPGVDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B07 | codons 1-229 | clone B07
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B02 | codons 1-229 | clone B02
PISPIETVPVKLKPGLDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW
>P132-71| B08 | codons 1-229 | clone B08
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFHW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005