<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB4-P101 P101-72 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 3TC+AZT 8
2 3TC+AZT+EFV 20
3 3TC+AZT+EFV+IDV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F L24I L10I, M36I, I62V, L63T, I93L  
>P101-72| D11 | codons 1-99 | clone D11
PQVTLWQRPIVTIKIGGQLKEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPVDIIGRNLLTQLGCTLNF
>P101-72| D12 | codons 1-99 | clone D12
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPRIIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPFNIIGRNLLTQLGCTLNF
>P101-72| D10 | codons 1-99 | clone D10
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPFNIIGRNLLTQLGCTLNF
>P101-72| D08 | codons 1-99 | clone D08
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPFNIIGRNILTQLGCTLNF
>P101-72| D04 | codons 1-99 | clone D04
PQITLWQRPIITIKIGGQLKEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVTIEVRGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P101-72| D06 | codons 1-99 | clone D06
PQITLWQRPIVTIEIGGQLKEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPFNIIGRNLLTQLGCTLNF
>P101-72| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVTIEICGHKAIGTVLVGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225H R83K, I135L, Q174H, Q207K, R211S  
>P101-72| D10 | codons 1-229 | clone D10
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| D11 | codons 1-229 | clone D11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| D12 | codons 1-229 | clone D12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| D04 | codons 1-229 | clone D04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGRHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| D06 | codons 1-229 | clone D06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENLYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| D08 | codons 1-229 | clone D08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMVKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGSKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYDVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDSYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW
>P101-72| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLLSWGFTTPDKKHQKEHPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005