<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P91 P91-98 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10V, I15V, E35D, N37D, L63P, A71V, I93L  
>P91-98| E05 | codons 1-99 | clone E05
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| E01 | codons 1-99 | clone E01
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| E03 | codons 1-99 | clone E03
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| E02 | codons 1-99 | clone E02
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| E07 | codons 1-99 | clone E07
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKVIGGIGGFAKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| E04 | codons 1-99 | clone E04
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF
>P91-98| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   S48T, K122E, S162C  
>P91-98| E07 | codons 1-229 | clone E07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-98| E05 | codons 1-229 | clone E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRQLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P91-98| E02 | codons 1-229 | clone E02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDVVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDNKHQKEPPFLW
>P91-98| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPNIVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P91-98| E01 | codons 1-229 | clone E01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRTKIEELGQHLLRWGFTTPDKKHQKEPPFLW
>P91-98| E03 | codons 1-229 | clone E03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFITPDKKHQKEHPFLW
>P91-98| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005