<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P91 P91-33 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, I15V, E35D, N37D, L63P, I93L I66T
>P91-33| D10 | codons 1-99 | clone D10
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIETCGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF
>P91-33| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFVKVRQYD
QIPIETCGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   P4S, S48T, W71*, K122E, S162C, R211G, L228F G155R
>P91-33| D10 | codons 1-229 | clone D10
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTK*RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKRSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFFW
>P91-33| codons 1-228
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTK*RKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKRSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFF

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005