<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
479-7344-2 479-7344-2 U.S. 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, M36I, K45R, L63P, I64L, V77I, I93L  
>479-7344-2| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPRMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K122E, I142V, F171Y, Q207E, R211K, E248N, A272P, K275Q, K277R, I293V, P294T  
>479-7344-2| codons 1-297
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPNKDSWTVNDIQKLVGKLNWASQIYPGIQVRQLCKLLRGTKALTEVVTLTE

References
Author Title Citation
Delwart, E Genetic diversity of recently acquired and prevalent HIV, hepatitis B virus, and hepatitis C virus infections in US blood donors. J Infect Dis, 2012