<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P84 P84-32 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V   T12S, L19I, E35D, N37D, L63P, I64V, I93L  
>P84-32| D06 | codons 1-99 | clone D06
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| D04 | codons 1-99 | clone D04
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| D08 | codons 1-99 | clone D08
PQITLWQRPLVSIEIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNL
>P84-32| D07 | codons 1-99 | clone D07
PQITPWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVDIIGRNLLTQIGCTLNF
>P84-32| D05 | codons 1-99 | clone D05
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| D01 | codons 1-99 | clone D01
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| D02 | codons 1-99 | clone D02
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGLKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| D03 | codons 1-99 | clone D03
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF
>P84-32| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVVVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   K32N, I135T, R211K  
>P84-32| D07 | codons 1-229 | clone D07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D03 | codons 1-229 | clone D03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHLAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQCNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D04 | codons 1-229 | clone D04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVRNLYRNGKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D06 | codons 1-229 | clone D06
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTRDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIAI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D01 | codons 1-229 | clone D01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPRGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D02 | codons 1-229 | clone D02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D08 | codons 1-229 | clone D08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| D05 | codons 1-229 | clone D05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
>P84-32| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005