<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P80 P80-74 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   E35D, L63P, I72V, I93L  
>P80-74| B09 | codons 1-99 | clone B09
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIRVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF
>P80-74| B08 | codons 1-99 | clone B08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF
>P80-74| B04 | codons 1-99 | clone B04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF
>P80-74| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRSLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35I, D121H, K122E, I135T, E169D, D177E, F214L  
>P80-74| B04 | codons 1-229 | clone B04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTDNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLW
>P80-74| B08 | codons 1-229 | clone B08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWGKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>P80-74| B09 | codons 1-229 | clone B09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW
>P80-74| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005