<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, K20I, E35N, M36I, N37DE, R41K, H69K, L89M  
>HJ1871| codons 1-99
PQITLWQRPLVTVKIGGQIIEALLDTGADDTVLENIELPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN       K11T, V21VI, E28EK, I31IM, V35T, T39K, S48SP, K122E, D123G, E169D, K173A, Q174K, D177E, I178L, G196E, I202V, E204EK, Q207A, R211RKNS, F214FL, V245Q, A272P, K275R, Q278N, T286A, E291D, I293V, E297A, I326V, G335GD K22KNT, L26LV, R78RK, E79EK
>HJ1871| codons 1-340
PISPIETVPVTLKPGMDGPKITQWPVTKEKMKALTEICKEMEKEGKIPKIGPENPYNTPV
FAIKKKNSTKWRKLVDFKKLNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPELVI
YQYMDDLYVGSDLEIEQHRTKVEKLRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKNLCKLLRGAKALTDVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQ

References
Author Title Citation
Aghokeng, AF Scale-up of antiretroviral treatment in sub-Saharan Africa is accompanied by increasing HIV-1 drug resistance mutations in drug-naive patients. AIDS, 2011