<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P72 P72-16 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10I, E35D, L63P, H69Q, I72V  
>P72-16| G11 | codons 1-99 | clone G11
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF
>P72-16| H02 | codons 1-99 | clone H02
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF
>P72-16| H03 | codons 1-99 | clone H03
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF
>P72-16| H07 | codons 1-99 | clone H07
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF
>P72-16| H01 | codons 1-99 | clone H01
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTTVNIIGRSLLTQIGCTLNF
>P72-16| H10 | codons 1-99 | clone H10
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLAQIGCTLNF
>P72-16| H09 | codons 1-99 | clone H09
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIRVKQYD
QIPIEICGQKAVGTVLVGPTPANIIGRNLLTQIGCTLNF
>P72-16| H05 | codons 1-99 | clone H05
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIRVKQYD
QIPIEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P72-16| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAVGTVLVGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y       S162C, I178L  
>P72-16| H02 | codons 1-229 | clone H02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| H03 | codons 1-229 | clone H03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
SAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGPDLEIGQHRTKIEELRQHLSRWGFYTPDKKHQKEPPFLW
>P72-16| H07 | codons 1-229 | clone H07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDAGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| H01 | codons 1-229 | clone H01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| H10 | codons 1-229 | clone H10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKMEELGQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| H09 | codons 1-229 | clone H09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEKLRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| G11 | codons 1-229 | clone G11
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDSRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005