<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P72 P72-24 U.S. 1997 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, F53L L10I, I15V, E35D, K55R, R57K, L63P, H69Q, A71V  
>P72-24| E12 | codons 1-99 | clone E12
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGLIRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P72-24| E06 | codons 1-99 | clone E06
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGLVRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P72-24| E08 | codons 1-99 | clone E08
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDMNLPGRWKPKLIGGIGGFVRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRDLLTQIGCTLNF
>P72-24| E05 | codons 1-99 | clone E05
PQITLWQRPIVTIKVGGQLKEALIDTGADGTVLEDMNLPGRWKPKMIGGIGGLVRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLMTQVGCTLNF
>P72-24| E04 | codons 1-99 | clone E04
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGLIRVKQYD
QIPIEICGQKVIGTVLVGPTPGNIIGRNLLTQIGCTLNF
>P72-24| E09 | codons 1-99 | clone E09
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFVRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLLTQIGCTLNF
>P72-24| codons 1-99
PQITLWQRPIVTIKVGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGLVRVKQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R       S162C, I178L  
>P72-24| E04 | codons 1-229 | clone E04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQCNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P72-24| E05 | codons 1-229 | clone E05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVPDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEMGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P72-24| E09 | codons 1-229 | clone E09
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P72-24| E06 | codons 1-229 | clone E06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLW
>P72-24| E08 | codons 1-229 | clone E08
PISPIKTVPVKLKPGMDGPKVKRWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRRYTAFTIPSISNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P72-24| E12 | codons 1-229 | clone E12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW
>P72-24| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005