<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, L33I, G48E, F53L L10I, I13V, K20T, E35D, N37D, R41K, Q61H, L63P, I64V, A71V, I72V, T74S, V77I, I93L T91TCS
>11484A| codons 1-99
PQITLWQRPIVTVKIGGQLTEALIDTGADDTVIEDMDLPGKWKPKLIEGIGGLVKVRQYD
HIPVEICGHKVVGSVLIGPTPANIIGRNLLSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       P4S, K43Q, E44D, V118I, K122E, I135T, Q174KN, T200K, Q207A, R211K, T286A, A288S, I293V, E297K, V317A, D324DE, Q334L, R356K, G359S, A371V, T377L  
>11484A| codons 1-400
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPDIVI
YQYVDDLYVGSDLEIGQHRKKIEELRAHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVVPLTKEAE
LELAENREILKEPVHGAYYDPSKELIAEIQKQGLGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEVVQKIALESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010