<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D_D, K70R, M184V K219Q Y188L V179D T27TS, V35AT, K64N, S68T, K102R, K103R, V118I, K122P, D123N, K173Q, D177E, Q207E, R211K, F214L, L228K, A288S, I293V, S322T, M357S, T377I, E399D  
>10208A| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAINKKDTDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRRKSVTVLDVGDAYFSIPL
DPNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPEIDI
YQYVDDLLVGSDLEIGQHRTKIEELREHLLKWGLTTPDQKHQKEPPFKWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARSRGA
HTNDVKQLTEAVQKIAIESIVIWGKTPKFKLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84IV, L90LM Q58QE L10LI, E35D, M36MI, I62IV, L63P, A71AV, I93L  
>10208A| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVREYD
QVPIEICGHKVIGTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010