<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215C, K219Q K103N A98G, Y318YF K20R, T39A, V60I, K64H, T69N, I135V, D177E, I202V, R211K, V245K, Q278H, T286A, I293V, I326V, I329V, Q334E, K390R  
>09859A| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPI
FAIHKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFCTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVFYDPSKDLVAEVQKQGEGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16GE, E35ED, N37NS, P39PS, D60E, I62V  
>09859A| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMSLSGRWKPKMIGGIGGFIKVRQYE
QVLIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010