<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A L10F, L24I, K43T, F53L T12P, K14R, G16E, E35D, M36I, N37T, K55R, R57K, I62V, L63H, I64V, H69HQ, A71V, V77I, I93L  
>09708A| codons 1-99
PQITLWQRPFVPIRIEGQLKEALIDTGADDTILEDITLPGRWTPKIVGGIGGLIRVKQYD
QVHVEICGQKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I K219Q, N348I Y181I   V35R, T39A, T69N, K122E, D123S, I135T, S162D, T200A, F214L, D218E, A288S, I293V, A327V, M357T, K366R, T377M, T386I, K388N P150PS
>09708A| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLSQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
IQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVRQLTEAVQKIAMESIVIWGKIPNFKLPIQKETWE

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010