<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DE, K70R, Q151M, M184V, T215F K219Q, N348NI K103S, G190A   V106I, G112A, K122E, D123DN, M164L, T200E, F214L, I293V, I341IF, M357T, E370ED, A376T, I382IL, T386A, K390R, T397V K30KR
>09676A| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEERIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSITVLDVADAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSLTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHREKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQFYQEPFKILKTGKYARTRGA
HTNDVKQLTDAVQKITTESIVLWGKAPKFRLPIQKEVWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46ML, V82VA, L90LM L33LF, K43KT L10LI, I13IV, N37ND, I62IV, L63LP, I66IF, A71AV, I72V  
>09676A| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTIFEEMDLPGRWTPKLIGGIGGFIKVRQYD
QVPIEFCGHKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010