<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, V75M, M184V, T215Y D67H, N348I L100I, K103N   S3C, E6EK, K20R, V35VI, K43E, E44A, K66N, T69N, K122E, I135T, I167IV, D177DN, I178IM, V179VI, H208Y, L210FY, R211K, K223KQ, L228R, A272P, K277R, T286TA, A288AS, I293V, E297KR, G333E, Q334L, M357I, K390R K73IM
>09214A| codons 1-399
PICPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FAIKKNHSNKWRMVMDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPNMII
YQYVDDLYVGSDLEIGQHRTKIEELRQYLYKWGFYTPDKKHQQEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQELGQWTYQIYQEPFKILKTGKYARIRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M L33F, Q58E, G73S L10I, I13V, K20R, L24F, E35DN, M36I, N37EQ, K55R, R57K, D60E, I62V, L63P, A71V, I72T P9PL, T31TI
>09214A| codons 1-99
PQITLWQRLIVTVKIGGQLREALFDTGADDIVFENIQLPGRWKPKLIGGIGGFVRVKEYE
QVPIEICGHKVTSTVLVGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010