<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P69 P69-44 U.S. 1998 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 42

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L24I E35D, R57K, L63P, K70R  
>P69-44| G10 | codons 1-99 | clone G10
PQITLWQRPPVTMEIGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRTIGTVLVGPTPVNIIGRNLLTQTGCTLNF
>P69-44| G12 | codons 1-99 | clone G12
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGRRVIGTVLVGPTPVNVIGRNLLTQIGCSLNF
>P69-44| G06 | codons 1-99 | clone G06
PQITLWQRPRVTIKMGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGRRAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
>P69-44| G03 | codons 1-99 | clone G03
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
>P69-44| G05 | codons 1-99 | clone G05
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRTIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P69-44| G07 | codons 1-99 | clone G07
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P69-44| G02 | codons 1-99 | clone G02
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRTIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P69-44| G08 | codons 1-99 | clone G08
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>P69-44| codons 1-99
PQITLWQRPLVTIKIGGQLKEALIDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103N P225H I178M, G196E, R211K  
>P69-44| G02 | codons 1-229 | clone G02
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQSPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G03 | codons 1-229 | clone G03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEREGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYTDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G07 | codons 1-229 | clone G07
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNGTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIKELREHLLRWGFTTPDKRHQKEPPFLW
>P69-44| G06 | codons 1-229 | clone G06
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G05 | codons 1-229 | clone G05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G08 | codons 1-229 | clone G08
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G12 | codons 1-229 | clone G12
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW
>P69-44| G10 | codons 1-229 | clone G10
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNALPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHRKEHPFLW
>P69-44| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005