<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50IV, I54T, V82A K43T, G73A, L89V L10I, I13V, L19P, K20M, E35G, M36I, I62V, L63P, C67CY, A71V P9PR
>08882A| codons 1-99
PQITLWQRRIVTVKIGGQPMEALLDTGADDTVLEGINLPGRWTPKMIVGVGGFTKVRQYD
QVPIEIYGHKVIATVLVGPTPANIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115F, Q151M, M184V A62V, K70T, V75I, F77L, F116Y K103KN P225PH I2V, P4S, K20R, V35IT, S68K, I135IL, E138EG, S162H, I167IV, I178IM, G196E, T200A, R211AG, A272P, K277R, T286A, E297K, T369A, A376V, T386A, K390R V111VIM
>08882A| codons 1-399
PVSSIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDKTTWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDMGDAFYSVPL
DKDFRKYTAFTIPSLNNGTPGIRYQYNVLPMGWKGSPAIFQHSMTKVLEPFRKQNPDMVI
YQYVDDLYVGSDLEIEQHRAKIEELRQHLLGWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLAEAVQKIVTESIVIWGKAPKFRLPIQKETWE

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010