<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q L100I, K103N   P4T, M16V, T69N, V90VI, D121H, K122E, I178ILM, V179VI, G196E, Q197QK, Q207E, L228H, A272P, K277R, I293V, E297A, G333E, Q334L, V365I, K390R, A400T E203EAKT
>08063A| codons 1-400
PISTIETVPVKLKPGVDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEIQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYMDDLYVGSDLEIEKHRTKITELREHLLRWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQELGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47A, V82VAIT, L90LM Q58QE L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71AITV, I93L  
>08063A| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIDLPGRWKPKMAGGIGGFIKVREYD
QVPIEICGHKVIGTVLVGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010