<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82A, L90M L33LF, G73S L10I, N37NCSY, I62V, L63P, H69K, A71IV, V77I, I93IM  
>07445A| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMYLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGKKVISTVLIGPTPANIIGRNLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   Y181C   K20KR, T69N, K122E, I135M, Q174N, V245M, A272P, K277R, T286A, E297Q, Q334E, R356K, M357T, I375IV, A376S, T386I, K390R  
>07445A| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKNNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDVKQLTEAVQKVSTESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010