<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C V179E P4T, K20R, E44D, V118I, D123E, I135T, D177N, V189VI, T200E, E203K, H208Y, R211K, K223E, F227Y, L228LH, A272P, I293V, E297T, I329IV, Q330E, Q334H, M357T, T386I, K390R, E399D G333EQ
>06928A| codons 1-399
PISTIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNIEI
CQYMDDLYIGSDLEIGQHREKIKELRQYLWKWGFYTPDNKHQEEPPYHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEVEKQQHGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82C, I84V, L90M V11VI, L33F, K43T, G73T, L89V L10I, I13V, K20R, E35D, M36I, N37D, I62V, L63P, A71T, P79S  
>06928A| codons 1-99
PQITLWQRPIITVKIGGQLREALLDTGADDTVFEDIDLPGRWTPKMIGGIGGFVKVRQYD
QVPIEICGHKTITTVLVGSTPCNVIGRNVMTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010