<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, T215Y A62AV, V75VI K103HN, Y181C, G190A A98G, V108I K20R, V35M, K64R, K102KR, K122E, D123DN, Q174R, I178L, T200A, Q207D, H208Y, R211K, H221Y, L228H, A272P, I293V, I326IV, Q334D, G335S, R356K, M357T, E370D, T377M, S379C  
>06350A| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FVIRKKDSGKWRKLIDFRELNKRTQDFWEVQLGIPHPGGLKRNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDLVI
CQYMDDLYVASDLEIGQHRAKIEELRDYLLKWGFYTPDKKYQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDSQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDVKQLTDAVQKIAMECIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M F53FL L10I, I13IV, K20I, E35D, M36I, N37D, R41K, I62IV, L63P, I64V, A71V, I72T, T74S, I93L  
>06350A| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKIIGGIGGLVKVRQYD
QVPVEICGHKVTGSVLVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010