<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_EA, V75VIM, L210W, T215Y A62AV, D67E K103N, Y181C, G190A A98G K20R, V35VI, K122E, Q174K, R211K, L228H, V245E, A288S, I293V, E297A, R356RK, M357T, T369V, K390R, E399D  
>06167A| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FVIKKKESTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKTRGA
HTNDVKQLVEAVQKIATESIVIWGKTPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33LI, G73S L10I, I15IV, K20I, M36I, R41K, I62V, L63C, A71V, I72L, I85IV  
>06167A| codons 1-99
PQITLWQRPIVTIKVGGQLIEALLDTGADDTVIEEINLPGKWKPKMIGGIGGFIKVRQYD
QVCIEICGHKVLSTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010