<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D   Y181C A98G I135T, S162C, F214L, L228R, E248D, T286A, I293V, R358K, E370G, T386I  
>06134A| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTGAVQKIATESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63S, I64L, K70R, V77I  
>06134A| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVSLEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010