<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82CST, I84V L24I, L33F, Q58E L10I, I13V, G16A, R41K, D60N, L63P, K70R, A71V  
>06133A| codons 1-99
PQITLWQRPIVTVKIAGQLKEALIDTGADDTVFEEMNLPGKWKPKLIGGIGGFVKVREYN
QIPIEICGHRVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y188L   V35L, T39A, K82KR, K102H, V118I, D123E, D177E, I178M, H208Y, R211K, D218E, A272P, I293V, E297K, Y339W, K350R, A355T, A376C, K390R  
>06133A| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKHKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLLVGSDLEIGQHRTKIEELRQYLWKWGFYTPENKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTWQIYQEPFKNLRTGKYTRMRGA
HTNDVKQLTEAVQKICTESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010