<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, G73T L10I, I13V, E34Q, E35D, M36I, I62V, L63P, H69Q, I72V, V77I, I93M A71MV
>06070A| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTIFQDINLPGRWTPKIVGGIGGFMKVRQYD
QVPIEICGQKVVTTVLIGPTPANIIGRNLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184I, L210W, T215Y   Y188L   E6K, T27S, V60I, V118I, K122E, I135V, E138A, E203K, Q207E, H208Y, R211K, K223E, V245EK, A288S, I293V, E297K, Q334E, G359S, A371V, A376CST, E399D  
>06070A| codons 1-399
PISPIKTVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLLVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKITTESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010