<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P60 P60-20 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 IDV 2
3 EFV+IDV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S I62V, L63P, A71V, V77I, I93L  
>P60-20| H01 | codons 1-99 | clone H01
PQITPWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF
>P60-20| H05 | codons 1-99 | clone H05
PQITLWQRPIVAIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPTNIIGRNLLTQLGCTLNF
>P60-20| H08 | codons 1-99 | clone H08
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVGQYD
QVPIKICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF
>P60-20| H06 | codons 1-99 | clone H06
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF
>P60-20| H04 | codons 1-99 | clone H04
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPTNIIGRNLMTQLGCTLNF
>P60-20| H03 | codons 1-99 | clone H03
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPTNIIGRNLMTQLGCTLNF
>P60-20| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T215C     E44D, V118I, K122E, D123N, S162C, Q207E, R211K  
>P60-20| H04 | codons 1-229 | clone H04
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFCTPDKKHQKEPPFLW
>P60-20| H01 | codons 1-229 | clone H01
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLW
>P60-20| H08 | codons 1-229 | clone H08
PISPIETVPVKLKPGMAGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFCTPDKKHQKEPPFLW
>P60-20| H06 | codons 1-229 | clone H06
PISPIETVPVELKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFCTPDKKHQKEPPFLW
>P60-20| H03 | codons 1-229 | clone H03
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLW
>P60-20| H05 | codons 1-229 | clone H05
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEEMREHLWKWGFCTPDKKHQKEPPFLW
>P60-20| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFCTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005