<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y N348I K103N, Y181C V108I K43KR, D123E, I135V, D177E, V189I, T200A, E203EK, L228H, A272S, E312N, D324E, G335D, E344D, R356K, M357G, R358G, G359S, E370K, T377R, T386TI, K390R  
>05572A| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYIGSDLEIGQHRAKIKELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKNPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQDPFKILKTGKYAKGGSA
HTNDVKQLTKAVQKIARESIVIWGKIPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, I54L, V82A L33F, F53L L10I, I13V, E34EQ, N37A, I64V, A71V, I72V, V77I  
>05572A| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTIFQEMALPGRWKPKIVGGVGGLLKVRQYD
QILVEICGHKVVGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Dau, B Connection domain mutations in treatment-experienced patients in the OPTIMA trial. JAIDS, 2010