<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LB3-P57 P57-16 U.S. 1996 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI NA
2 EFV 2
3 EFV+IDV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, N37D, L63S, A71V, I93L  
>P57-16| A11g | codons 1-99 | clone A11g
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A07q | codons 1-99 | clone A07q
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVKQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A02y | codons 1-99 | clone A02y
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QISIEICGHKVIGTVVVGPTPVNIIGRNLLTQPGCTLNF
>P57-16| A03p | codons 1-99 | clone A03p
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKVIGSVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A08k | codons 1-99 | clone A08k
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLSGRWKPKMIGGIGGFIKVRQYD
QISIGICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A10c | codons 1-99 | clone A10c
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A12d | codons 1-99 | clone A12d
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| A04q | codons 1-99 | clone A04q
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF
>P57-16| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   Q207H, R211K  
>P57-16| A03p | codons 1-229 | clone A03p
PISPIETVPVKLKPGKDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A12d | codons 1-229 | clone A12d
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFAIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRHHLLKWGFTTPDKKHQKEHPFLW
>P57-16| A04q | codons 1-229 | clone A04q
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A11g | codons 1-229 | clone A11g
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIG*HRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A10c | codons 1-229 | clone A10c
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A08k | codons 1-229 | clone A08k
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A07q | codons 1-229 | clone A07q
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| A02y | codons 1-229 | clone A02y
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW
>P57-16| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDKKHQKEPPFLW

References
Author Title Citation
Bacheler, LT Human immunodeficiency virus type 1 mutations selected in patients failing efavirenz combination therapy. AAC, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005